DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppp1ca and Pp1-13C

DIOPT Version :9

Sequence 1:NP_113715.1 Gene:Ppp1ca / 24668 RGDID:3375 Length:330 Species:Rattus norvegicus
Sequence 2:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster


Alignment Length:300 Identity:275/300 - (91%)
Similarity:285/300 - (95%) Gaps:0/300 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     4 SEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQ 68
            :|.|||:|||.|||||:|:||||||||:|.||||||||||||.|:||||||||||||||||||||
  Fly     2 AEVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQ 66

  Rat    69 YYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRI 133
            ||||||||||||:|||:|||||||||||||||||||||||||||||.||||||||||||||||||
  Fly    67 YYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRI 131

  Rat   134 YGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQ 198
            |||||||||||.|||||||||||||||:.||||||||||||||||||.|||||||||||||||||
  Fly   132 YGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQ 196

  Rat   199 GLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263
            ||||||||||||||..||||||||||||||||||.|||.||||||||||||||||||||||||||
  Fly   197 GLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQL 261

  Rat   264 VTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNK 303
            |||||||||||||||||||||||.|||||||||||.:|.|
  Fly   262 VTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppp1caNP_113715.1 MPP_PP1_PPKL 8..298 CDD:277359 269/289 (93%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 272/293 (93%)
MPP_PP1_PPKL 6..296 CDD:277359 269/289 (93%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340877
Domainoid 1 1.000 395 1.000 Domainoid score I733
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.720

Return to query results.
Submit another query.