DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57d and Obp57c

DIOPT Version :9

Sequence 1:NP_725973.1 Gene:Obp57d / 246671 FlyBaseID:FBgn0043536 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster


Alignment Length:130 Identity:28/130 - (21%)
Similarity:58/130 - (44%) Gaps:18/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LACIIFILEIQFR----IADSN--DPCPHNQGIDE-DIAESILGDWPANVDLTSVKRSHKCYVTC 70
            |.||:.:..:..:    :.::|  ..|..:..|.: :..|.|..:.....||.:..|.:||::.|
  Fly     6 LICILTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQELIDRNSSEEDDLENTDRRYKCFIHC 70

  Fly    71 ILQYYNIVTASGEIFLDKYYDTGVIDEL-AVAPKINR----CRYEFRMETDYCSRIFAIFNCLRQ 130
            :.:..|::..:|      |.|...||:: .|:.::..    |:..:..|.|:|...|.:..||.:
  Fly    71 LAEKGNLLDTNG------YLDVDKIDQIEPVSDELREILYDCKKIYDEEEDHCEYAFKMVTCLTE 129

  Fly   131  130
              Fly   130  129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57dNP_725973.1 PBP_GOBP <38..131 CDD:279703 23/99 (23%)
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016906
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.