DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57d and Obp56e

DIOPT Version :10

Sequence 1:NP_725973.1 Gene:Obp57d / 246671 FlyBaseID:FBgn0043536 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster


Alignment Length:100 Identity:22/100 - (22%)
Similarity:43/100 - (43%) Gaps:16/100 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CPHNQGIDEDIAESILGDWPANVDLTSVKRSHKCYVTCILQYYNIVTASGEIFLDKYYDTGVIDE 97
            |...:||.::.|.::.....|:.|     ...||:..|.|:...:| |:|:|..|.     |:.:
  Fly    36 CVKQEGITKEQAIALRSGNFADSD-----PKVKCFANCFLEQTGLV-ANGQIKPDV-----VLAK 89

  Fly    98 LA-VAPKIN----RCRYEFRMETDYCSRIFAIFNC 127
            |. :|.:.|    :.:.:.....|.|...:.::.|
  Fly    90 LGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYKC 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57dNP_725973.1 PBP_GOBP 43..132 CDD:472229 18/89 (20%)
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:460193 21/99 (21%)

Return to query results.
Submit another query.