DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56f and Obp99a

DIOPT Version :9

Sequence 1:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_001287586.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster


Alignment Length:134 Identity:26/134 - (19%)
Similarity:51/134 - (38%) Gaps:25/134 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLLFIFISAIWLQAFCMKSSEKIKA----CLKRQLGYTITENTKFDAKE--DSLQSKCFYHC 59
            ||||:....:..:....:.:|:...:.|    |:| :|...:....|:...|  :..:::|:..|
  Fly     1 MKVFVAICVLIGLASADYVVKNRHDMLAYRDECVK-ELAVPVDLVEKYQKWEYPNDAKTQCYIKC 64

  Fly    60 LLEVKGVIANDAISSEQPRKVLEKKYG-ITDTDE---------LEKAEEKCHSIKASGKCELGYE 114
            :....|:.  |..|......:.::..| ..|.:|         ::|.|:      .|..||..|.
  Fly    65 VFTKWGLF--DVQSGFNVENIHQQLVGNHADHNEAFHASLAACVDKNEQ------GSNACEWAYR 121

  Fly   115 ILKC 118
            ...|
  Fly   122 GATC 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56fNP_725926.1 PBP_GOBP <52..120 CDD:279703 15/77 (19%)
Obp99aNP_001287586.1 PhBP 29..130 CDD:214783 20/106 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.