DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56f and Obp56h

DIOPT Version :10

Sequence 1:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_611448.2 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster


Alignment Length:111 Identity:27/111 - (24%)
Similarity:52/111 - (46%) Gaps:11/111 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CMKSSEKIKACLKRQLGYTITENTKFDAKEDSLQSKCFYHCLLEVKGVIANDAISSEQPRKVLEK 83
            ||::::..:|.||.    .:....:..|||:   .||:..||:|.:|.:.|...:::.....|:.
  Fly    30 CMETNQVTEADLKE----FMASGMQSSAKEN---LKCYTKCLMEKQGHLTNGQFNAQAMLDTLKN 87

  Fly    84 KYGITD-TDELEKAEEKCHSIKASGKCELGYEILKC---YQSITKH 125
            ...|.| .||:......|..||.:..|:..:::..|   :::|..|
  Fly    88 VPQIKDKMDEISSGVNACKDIKGTNDCDTAFKVTMCLKEHKAIPGH 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56fNP_725926.1 PBP_GOBP <49..120 CDD:460193 17/74 (23%)
Obp56hNP_611448.2 PhBP 26..128 CDD:214783 25/104 (24%)

Return to query results.
Submit another query.