DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56f and Obp56d

DIOPT Version :9

Sequence 1:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_001286619.1 Gene:Obp56d / 37266 FlyBaseID:FBgn0034470 Length:131 Species:Drosophila melanogaster


Alignment Length:136 Identity:36/136 - (26%)
Similarity:58/136 - (42%) Gaps:17/136 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLLFIFISAIWLQAFCMKSSEKIKA------CLKRQLGYT-----ITENTKFDAKEDSLQSK 54
            ||..::...|.||......:...:|..|      |.::: |.|     ...|..||..:..:  |
  Fly     1 MKFLIVLSVILAISAAELQLSDEQKAVAHANGALCAQQE-GITKDQAIALRNGNFDDSDPKV--K 62

  Fly    55 CFYHCLLEVKGVIANDAISSEQPRKVLEKKYGITDTDELEKAEEKCHSIKASGKCELGYEILKCY 119
            ||.:|.||..|.:.|..:   ||..||.|...:...|.::..:.||.:.|.:.||:..|::.:||
  Fly    63 CFANCFLEKIGFLINGEV---QPDVVLAKLGPLAGEDAVKAVQAKCDATKGADKCDTAYQLFECY 124

  Fly   120 QSITKH 125
            .....|
  Fly   125 YKNRAH 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56fNP_725926.1 PBP_GOBP <52..120 CDD:279703 21/67 (31%)
Obp56dNP_001286619.1 PBP_GOBP 19..127 CDD:279703 30/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.