DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56f and Obp56a

DIOPT Version :10

Sequence 1:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster


Alignment Length:102 Identity:28/102 - (27%)
Similarity:48/102 - (47%) Gaps:14/102 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SEKIKACLKRQLGYTITENTKFDAKE---DSLQSKCFYHCLLEVKGVIANDAISSEQPRKVLEKK 84
            :|::|        .|..|..|.:||:   .:...|||.:|..|..|.:.:..:   |...||||.
  Fly    40 AEEVK--------LTEEEKAKVNAKDFNNPTENIKCFANCFFEKVGTLKDGEL---QESVVLEKL 93

  Fly    85 YGITDTDELEKAEEKCHSIKASGKCELGYEILKCYQS 121
            ..:...::.:.|.|||.:||...||:...::..|::|
  Fly    94 GALIGEEKTKAALEKCRTIKGENKCDTASKLYDCFES 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56fNP_725926.1 PBP_GOBP <49..120 CDD:460193 20/70 (29%)
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:460193 26/98 (27%)

Return to query results.
Submit another query.