DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56f and Obp28a

DIOPT Version :10

Sequence 1:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster


Alignment Length:129 Identity:29/129 - (22%)
Similarity:47/129 - (36%) Gaps:29/129 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 GLRLVERK----------RFEEVFDENSSRKQGLLEKMQALEMYPPPYGRFNGDDQRKEPEQYQH 332
            |..|::||          |..::.|.:|..:....|...|:|........|: ::...|.|..::
  Fly    91 GKPLLQRKKNPSNPSKKSRLLQICDSSSDEEADGREAGAAIEQRSERLVEFD-EETPMETEIEEN 154

  Fly   333 AEEYGRQMS--------------NRHQFRVGTLSQKEWEAATLYLFFAFQKMKTSYD----ANG 378
            .:|.||:.|              ||::.:|..|..|.:.....||.........|.|    |||
  Fly   155 KKEEGRKPSLSPEKPVENDSNSVNRNRGKVKKLVTKTYTDEEGYLITVKDYEMVSEDDESTANG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56fNP_725926.1 PBP_GOBP <49..120 CDD:460193
Obp28aNP_523505.1 PBP_GOBP 24..134 CDD:460193 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.