powered by:
Protein Alignment Obp56f and Obp8a
DIOPT Version :9
Sequence 1: | NP_725926.1 |
Gene: | Obp56f / 246668 |
FlyBaseID: | FBgn0043533 |
Length: | 125 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_727322.1 |
Gene: | Obp8a / 31860 |
FlyBaseID: | FBgn0030103 |
Length: | 163 |
Species: | Drosophila melanogaster |
Alignment Length: | 48 |
Identity: | 13/48 - (27%) |
Similarity: | 22/48 - (45%) |
Gaps: | 10/48 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 MKSSEKIKACLK------RQLGYTITENTKFDAK--EDSLQSKCFYHC 59
|:||.:..|.|: |:| |..:..:.|.. ||:...:.:.||
Fly 31 MRSSPQSLALLRARDQCGREL--TAAQRLQLDRMQFEDAAHVRHYLHC 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11857 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.