DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and Obp83ef

DIOPT Version :9

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster


Alignment Length:68 Identity:14/68 - (20%)
Similarity:26/68 - (38%) Gaps:22/68 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFFTCCALLLVVVTLPTCFVQAGPIKDQCMAAAGITAQDVA--NRHETDDPGHSVKCFFRCFLE 63
            ||..|..:.||                 ||......|..::.  ::.::.:|   :.|.|:||.:
  Fly   125 MHAGTSLSTLL-----------------QCSRQLNATNVELLQYSKLKSKEP---IPCLFQCFAD 169

  Fly    64 NIG 66
            .:|
  Fly   170 AMG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:279703 9/44 (20%)
Obp83efNP_731042.1 PhBP 28..124 CDD:214783
PhBP 133..234 CDD:214783 11/60 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.