powered by:
Protein Alignment Obp56i and Obp83ef
DIOPT Version :9
Sequence 1: | NP_725929.1 |
Gene: | Obp56i / 246667 |
FlyBaseID: | FBgn0043532 |
Length: | 140 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_731042.1 |
Gene: | Obp83ef / 40747 |
FlyBaseID: | FBgn0046876 |
Length: | 245 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 14/68 - (20%) |
Similarity: | 26/68 - (38%) |
Gaps: | 22/68 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MHFFTCCALLLVVVTLPTCFVQAGPIKDQCMAAAGITAQDVA--NRHETDDPGHSVKCFFRCFLE 63
||..|..:.|| ||......|..::. ::.::.:| :.|.|:||.:
Fly 125 MHAGTSLSTLL-----------------QCSRQLNATNVELLQYSKLKSKEP---IPCLFQCFAD 169
Fly 64 NIG 66
.:|
Fly 170 AMG 172
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Obp56i | NP_725929.1 |
PBP_GOBP |
25..121 |
CDD:279703 |
9/44 (20%) |
Obp83ef | NP_731042.1 |
PhBP |
28..124 |
CDD:214783 |
|
PhBP |
133..234 |
CDD:214783 |
11/60 (18%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11857 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.