DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and Obp57c

DIOPT Version :9

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster


Alignment Length:152 Identity:34/152 - (22%)
Similarity:63/152 - (41%) Gaps:38/152 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CALLLVVVTLPTCFV--QAGPIKDQCMAAAGITA---QDVANRH--ETDD---PGHSVKCFFRCF 61
            |.|.:.||::.:..:  :...:.| |:|:..|:.   |::.:|:  |.||   .....|||..|.
  Fly     8 CILTVSVVSIQSLSLLEETNYVSD-CLASNNISQAEFQELIDRNSSEEDDLENTDRRYKCFIHCL 71

  Fly    62 LENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEAT----------CNMIKSETSHDESCEFAWQ 116
            .|...::..|    |..|        .:.::::|..          |..|..|  .::.||:|::
  Fly    72 AEKGNLLDTN----GYLD--------VDKIDQIEPVSDELREILYDCKKIYDE--EEDHCEYAFK 122

  Fly   117 ISECY-EGVRLSD--VKKGQRT 135
            :..|. |....||  .:.|:.|
  Fly   123 MVTCLTESFEQSDEVTEAGKNT 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:279703 24/113 (21%)
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.