DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and Obp47a

DIOPT Version :9

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:82 Identity:20/82 - (24%)
Similarity:38/82 - (46%) Gaps:6/82 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RHETDDPGHSVKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNMIKSETSHD 108
            |.:..||..||:||..|..|.:|::.|...:......:|..:...:...  |..|:.|:.    :
  Fly    64 REDFSDPSESVQCFTHCLYEQMGLMHDGVFVERDLFGLLSDVSNTDYWP--ERQCHAIRG----N 122

  Fly   109 ESCEFAWQISECYEGVR 125
            ..||.|::|.:|.:.::
  Fly   123 NKCETAYRIHQCQQQLK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:279703 19/76 (25%)
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113266at33392
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.