DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and AgaP_AGAP012322

DIOPT Version :9

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_551868.2 Gene:AgaP_AGAP012322 / 3291553 VectorBaseID:AGAP012322 Length:135 Species:Anopheles gambiae


Alignment Length:109 Identity:25/109 - (22%)
Similarity:46/109 - (42%) Gaps:9/109 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AGPIKDQCMAAAGITAQDVANR---HETDDPGHSVKCFFRCFLENIGII-ADNQIIPGAFDRVLG 83
            |..:..:||...|.:..|| ||   .:|:....:.:||.:||.:..|.: .|..:......:.|.
Mosquito    29 ARQLAGKCMQQTGASEDDV-NRLRSGDTEGADRNTRCFVQCFFQGAGFVDQDGSVQTDELTQKLA 92

  Fly    84 HIVTAEAVERMEATCNMIKSETSHDESCEFAWQISECYEGVRLS 127
            .....|..:.:.|.|.    .....::||.::::.:||...|.|
Mosquito    93 SEYGQEKADELVARCR----NNDGPDACERSFRLLQCYMENRAS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:279703 20/99 (20%)
AgaP_AGAP012322XP_551868.2 PBP_GOBP 19..129 CDD:279703 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113266at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11857
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.