DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and Obp8a

DIOPT Version :9

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster


Alignment Length:157 Identity:36/157 - (22%)
Similarity:55/157 - (35%) Gaps:43/157 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLVVVTLPTCFVQAGPIKDQCMAAAGITAQDVANRHET------------DDPGHSVKCFFRCF 61
            |||:||.|....:.. |::....:.|.:.|:|...|..|            :|..| |:.:..||
  Fly    15 LLLLVVELTPPAIPV-PMRSSPQSLALLRARDQCGRELTAAQRLQLDRMQFEDAAH-VRHYLHCF 77

  Fly    62 -------LENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNMIKSETSHDES--------- 110
                   |:..|..|...:.....:|.|.       ||:.....|...::||...|         
  Fly    78 WSRLQLWLDETGFQAQRIVQSFGGERRLN-------VEQALPAINGCNAKTSSRGSGAQTVVDWC 135

  Fly   111 -----CEFAWQISECYEGVRLSDVKKG 132
                 |..|..:.|.|:. .:|||..|
  Fly   136 FRAFVCVLATPVGEWYKR-HMSDVING 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:279703 25/128 (20%)
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 21/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.