DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and OBP26

DIOPT Version :9

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_551869.1 Gene:OBP26 / 1280376 VectorBaseID:AGAP012321 Length:131 Species:Anopheles gambiae


Alignment Length:101 Identity:25/101 - (24%)
Similarity:40/101 - (39%) Gaps:20/101 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QCMAAAGITAQDVANRHETDDPG--HSVKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAV 91
            :|:...|:..:..|.....|..|  ...|||.:||||..|.:.|.           |.|.....:
Mosquito    33 ECVKTTGVPPETAAKLKGGDFAGADDKTKCFAKCFLEKAGFMTDK-----------GEIDEKTVI 86

  Fly    92 ERMEATCNMIKSE-----TSHDES--CEFAWQISEC 120
            |::....:..|.|     .:|.|:  ||.|::..:|
Mosquito    87 EKLSVDHDRAKVEGLVKKCNHKEANPCETAFKAYQC 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:279703 25/101 (25%)
OBP26XP_551869.1 PBP_GOBP 18..126 CDD:279703 25/101 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113266at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11857
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.