DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and OBP17

DIOPT Version :9

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_319537.3 Gene:OBP17 / 1279770 VectorBaseID:AGAP003309 Length:149 Species:Anopheles gambiae


Alignment Length:145 Identity:30/145 - (20%)
Similarity:53/145 - (36%) Gaps:38/145 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCALLLVVVT--------LPTCFVQAGPIKDQCMAAAGITAQDVANRHETDDPGH---SVKCFFR 59
            ||::.|...|        .|.......|:.|.|:...|:|.:  |.:..:|:..|   .:||:..
Mosquito    13 CCSMTLGDTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEE--AIKKFSDEEIHEDEKLKCYMN 75

  Fly    60 CFLENIGIIADN---------QIIPGAFDRVLGHIVTAEAVERMEATCNMIKSETSHDESCEFAW 115
            |......::.||         ..:|.:...:..|         |...|...:.||    .|:.|:
Mosquito    76 CLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMH---------MGKRCLYPEGET----LCDKAF 127

  Fly   116 QISECYEGVRLSDVK 130
            .:.:|:   :.||.|
Mosquito   128 WLHKCW---KQSDPK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:279703 21/107 (20%)
OBP17XP_319537.3 PBP_GOBP 32..135 CDD:279703 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.