DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and OBP9

DIOPT Version :9

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_310842.1 Gene:OBP9 / 1271980 VectorBaseID:AGAP000278 Length:139 Species:Anopheles gambiae


Alignment Length:112 Identity:27/112 - (24%)
Similarity:50/112 - (44%) Gaps:21/112 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QCMAAAGITAQDVA-----NRHETDDPGHSVKCFF---RCFLENIGIIADNQIIPGAFDRVLGHI 85
            :|:.:.|::.:.|.     |..|.|.....:||.|   :.|.:..|.|.||.::..|..|     
Mosquito    33 ECVKSLGVSDELVEKYKSWNFPEDDTTQCYIKCIFNKMQLFDDTNGPIVDNLVVQLAHGR----- 92

  Fly    86 VTAEAVERMEATCNMIKSETSHDES--CEFAWQISECYEGVRLSDVK 130
               :|.|..|   .::|...|:.:.  |.:|::..:|::...||.:|
Mosquito    93 ---DANEVRE---EIVKCAGSNTDGNVCHWAFRGFQCFQKNNLSLIK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:279703 23/101 (23%)
OBP9XP_310842.1 PBP_GOBP 16..127 CDD:279703 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.