DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp51a and Obp57c

DIOPT Version :9

Sequence 1:NP_725436.1 Gene:Obp51a / 246666 FlyBaseID:FBgn0043530 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster


Alignment Length:134 Identity:35/134 - (26%)
Similarity:58/134 - (43%) Gaps:23/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFIGLVLLLAVTTLSSALFESEAN---ECAKKLGITPDYFENF--PHSS----------RVKC 50
            :|:::..:|.::|.::.|.....|.|   :|.....|:...|:..  .:||          |.||
  Fly     2 LKLWLICILTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQELIDRNSSEEDDLENTDRRYKC 66

  Fly    51 FYHCQMEKLEII-ANGVVTPFDL-KVLNISPESYDKYGVKVKPCLKL--SHRDKCELGYLVFQCL 111
            |.||..||..:: .||.:   |: |:..|.|.| |:....:..|.|:  ...|.||..:.:..||
  Fly    67 FIHCLAEKGNLLDTNGYL---DVDKIDQIEPVS-DELREILYDCKKIYDEEEDHCEYAFKMVTCL 127

  Fly   112 KREF 115
            ...|
  Fly   128 TESF 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp51aNP_725436.1 PBP_GOBP 25..114 CDD:279703 29/107 (27%)
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.