DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp51a and Obp56a

DIOPT Version :9

Sequence 1:NP_725436.1 Gene:Obp51a / 246666 FlyBaseID:FBgn0043530 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster


Alignment Length:130 Identity:27/130 - (20%)
Similarity:52/130 - (40%) Gaps:29/130 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IGLVLLLAVTTLSSALFESE---------ANECAKKLGITPDY--------FENFPHSSRVKCFY 52
            |.|..|.....:.|:|..|:         ..:||:::.:|.:.        |.|  .:..:|||.
  Fly     7 IALSALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEKAKVNAKDFNN--PTENIKCFA 69

  Fly    53 HCQMEKLEIIANGVVTPFDLKVLN-----ISPESYDKYGVKVKPCLKLSHRDKCELGYLVFQCLK 112
            :|..||:..:.:|.:.  :..||.     |..|   |....::.|..:...:||:....::.|.:
  Fly    70 NCFFEKVGTLKDGELQ--ESVVLEKLGALIGEE---KTKAALEKCRTIKGENKCDTASKLYDCFE 129

  Fly   113  112
              Fly   130  129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp51aNP_725436.1 PBP_GOBP 25..114 CDD:279703 21/101 (21%)
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:279703 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.