DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp51a and Obp56c

DIOPT Version :9

Sequence 1:NP_725436.1 Gene:Obp51a / 246666 FlyBaseID:FBgn0043530 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster


Alignment Length:69 Identity:18/69 - (26%)
Similarity:32/69 - (46%) Gaps:6/69 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 HSSRVKCFYHCQMEKLEIIANGVV--TPFDLKVLNISPESYDKYGVKVKPCLKLSHRDKCELGYL 106
            |:..::||..|..|.|::....|:  ..|..:|..|.  .::|  .::|.|..|..:.:||..|.
  Fly   130 HNEPLQCFVSCLYETLDLDRYNVLLEEAFKNQVQTII--QHEK--AEIKECSDLQGKTRCEAAYK 190

  Fly   107 VFQC 110
            :..|
  Fly   191 LHLC 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp51aNP_725436.1 PBP_GOBP 25..114 CDD:279703 18/69 (26%)
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.