powered by:
Protein Alignment Obp51a and Obp56c
DIOPT Version :9
Sequence 1: | NP_725436.1 |
Gene: | Obp51a / 246666 |
FlyBaseID: | FBgn0043530 |
Length: | 117 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_995902.1 |
Gene: | Obp56c / 170882 |
FlyBaseID: | FBgn0046879 |
Length: | 245 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 18/69 - (26%) |
Similarity: | 32/69 - (46%) |
Gaps: | 6/69 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 HSSRVKCFYHCQMEKLEIIANGVV--TPFDLKVLNISPESYDKYGVKVKPCLKLSHRDKCELGYL 106
|:..::||..|..|.|::....|: ..|..:|..|. .::| .::|.|..|..:.:||..|.
Fly 130 HNEPLQCFVSCLYETLDLDRYNVLLEEAFKNQVQTII--QHEK--AEIKECSDLQGKTRCEAAYK 190
Fly 107 VFQC 110
:..|
Fly 191 LHLC 194
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006711 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11857 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.100 |
|
Return to query results.
Submit another query.