DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-1 and PRDX2

DIOPT Version :9

Sequence 1:NP_724931.1 Gene:Prx2540-1 / 246663 FlyBaseID:FBgn0033520 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_005800.3 Gene:PRDX2 / 7001 HGNCID:9353 Length:198 Species:Homo sapiens


Alignment Length:204 Identity:66/204 - (32%)
Similarity:98/204 - (48%) Gaps:27/204 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLGQTVPNFEA----DTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNT 62
            |:|:..|:|:|    |.....:|..:::| .:||||.:|.|||.||.||:...:....:|.|...
Human     7 RIGKPAPDFKATAVVDGAFKEVKLSDYKG-KYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC 70

  Fly    63 KCLAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEEQKKDPE 121
            :.|..|||:..:|:.|:|        .|      |....|::||.||.|:...|:|..::     
Human    71 EVLGVSVDSQFTHLAWIN--------TPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDE----- 122

  Fly   122 VGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMIL 186
             |...|.||||.....:|......:..||:|||.||.:.:.|.||....|. ||.|.||:.. |.
Human   123 -GIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVC-PAGWKPGSDT-IK 184

  Fly   187 PTVTDEEAH 195
            |.|.|.:.:
Human   185 PNVDDSKEY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-1NP_724931.1 AhpC 1..194 CDD:223527 66/201 (33%)
PRX_1cys 3..218 CDD:239314 65/203 (32%)
PRDX2NP_005800.3 PRX_Typ2cys 8..179 CDD:239313 59/186 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.