DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-1 and Prx3

DIOPT Version :9

Sequence 1:NP_724931.1 Gene:Prx2540-1 / 246663 FlyBaseID:FBgn0033520 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster


Alignment Length:207 Identity:70/207 - (33%)
Similarity:109/207 - (52%) Gaps:21/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLGQTVPNFE----ADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRN 61
            :|:.|..|:|:    .|.:...:|..:::| .::|||.:|.|||.||.||:...:....||...|
  Fly    40 VRVQQPAPDFKGLAVVDNSFQEVKLEDYRG-KYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDIN 103

  Fly    62 TKCLAHSVDALNSHVDWVN-DIKSYCLDIPGDFPYPIIADPTRDLAVTLG-MLDEEQKKDPEVGK 124
            |:.|..|||:..||:.|.| |.|:..:   |...||:::|.|:.::.... :||:|       |.
  Fly   104 TEVLGVSVDSHFSHLTWCNVDRKNGGV---GQLKYPLLSDLTKKISADYDVLLDKE-------GI 158

  Fly   125 TIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTK-VMILPT 188
            ::|..|||.|:..:|......:..||:|||:||.|.:.|..::...|. ||||.|.:. ..|.|.
  Fly   159 SLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVC-PANWNPNSNPATIKPD 222

  Fly   189 VTDEEAHKLFPK 200
            |  ||:.|.|.|
  Fly   223 V--EESKKYFSK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-1NP_724931.1 AhpC 1..194 CDD:223527 66/199 (33%)
PRX_1cys 3..218 CDD:239314 69/205 (34%)
Prx3NP_524387.1 AhpC 40..233 CDD:223527 70/207 (34%)
PRX_Typ2cys 42..212 CDD:239313 60/181 (33%)
1-cysPrx_C 195..232 CDD:287400 14/39 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.