DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-1 and prdx3

DIOPT Version :9

Sequence 1:NP_724931.1 Gene:Prx2540-1 / 246663 FlyBaseID:FBgn0033520 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001013478.3 Gene:prdx3 / 373079 ZFINID:ZDB-GENE-030826-18 Length:250 Species:Danio rerio


Alignment Length:211 Identity:67/211 - (31%)
Similarity:100/211 - (47%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QTVPNFEADTT-KGPIK---FHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCL 65
            |..|:|:.... .|..|   ..:::| .::|||.:|.|||.||.||:...:....||...|...:
Zfish    62 QAAPHFKGTAVINGEFKEISLGDFKG-KYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCAVV 125

  Fly    66 AHSVDALNSHVDWVN-DIKSYCLDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRAL 129
            ..|||:..:|:.|.| ..||..|   |....|::||.|:.::...|:|.|..      |..:|.|
Zfish   126 GVSVDSHFTHLAWTNTPRKSGGL---GKIQIPLLADLTKQVSRDYGVLLEGP------GIALRGL 181

  Fly   130 FIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTVTDEEA 194
            |||.|:..||......:..||:|:|.||.:.:.|..:....|. ||:|||.:     ||:     
Zfish   182 FIIDPNGIVRHMSVNDLPVGRSVEETLRLVKAFQFVETHGEVC-PASWTPKS-----PTI----- 235

  Fly   195 HKLFPKG----FDKVS 206
             |..|.|    |:||:
Zfish   236 -KPTPDGSKEYFEKVN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-1NP_724931.1 AhpC 1..194 CDD:223527 61/193 (32%)
PRX_1cys 3..218 CDD:239314 67/211 (32%)
prdx3NP_001013478.3 PRX_Typ2cys 60..230 CDD:239313 57/178 (32%)
PTZ00253 64..250 CDD:140280 65/207 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.