DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-1 and CG12896

DIOPT Version :9

Sequence 1:NP_724931.1 Gene:Prx2540-1 / 246663 FlyBaseID:FBgn0033520 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster


Alignment Length:220 Identity:218/220 - (99%)
Similarity:220/220 - (100%) Gaps:0/220 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCL 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCL 65

  Fly    66 AHSVDALNSHVDWVNDIKSYCLDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRALF 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 AHSVDALNSHVDWVNDIKSYCLDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRALF 130

  Fly   131 IISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTVTDEEAH 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||:|||
  Fly   131 IISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPSVTDDEAH 195

  Fly   196 KLFPKGFDKVSMPSGVNYVRTTENY 220
            |||||||||||||||||||||||||
  Fly   196 KLFPKGFDKVSMPSGVNYVRTTENY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-1NP_724931.1 AhpC 1..194 CDD:223527 190/192 (99%)
PRX_1cys 3..218 CDD:239314 212/214 (99%)
CG12896NP_610584.2 AhpC 1..194 CDD:223527 190/192 (99%)
PRX_1cys 3..218 CDD:239314 212/214 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468921
Domainoid 1 1.000 126 1.000 Domainoid score I1772
eggNOG 1 0.900 - - E1_COG0450
Homologene 1 1.000 - - H71226
Inparanoid 1 1.050 205 1.000 Inparanoid score I1281
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101151at33392
OrthoFinder 1 1.000 - - FOG0002615
OrthoInspector 1 1.000 - - otm3349
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - P PTHR43503
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1721
1211.800

Return to query results.
Submit another query.