DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-1 and Prdx1

DIOPT Version :9

Sequence 1:NP_724931.1 Gene:Prx2540-1 / 246663 FlyBaseID:FBgn0033520 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_476455.1 Gene:Prdx1 / 117254 RGDID:620039 Length:199 Species:Rattus norvegicus


Alignment Length:199 Identity:64/199 - (32%)
Similarity:97/199 - (48%) Gaps:16/199 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLGQTVPNFEA-----DTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRN 61
            ::|...|:|:|     |.....|...:::| .:||.|.:|.|||.||.||:...:....||.|.|
  Rat     7 KIGHPAPSFKATAVMPDGQFKDISLSDYKG-KYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN 70

  Fly    62 TKCLAHSVDALNSHVDWVNDIKSYCLDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTI 126
            .:.:..|||:...|:.|:|..|..  ...|....|:::||.|.:|...|:|..::      |.:.
  Rat    71 CQVIGASVDSHFCHLAWINTPKKQ--GGLGPMNIPLVSDPKRTIAQDYGVLKADE------GISF 127

  Fly   127 RALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTVTD 191
            |.||||.....:|......:..||:||||||.:.:.|.||:...|. ||.|.||:.. |.|.|..
  Rat   128 RGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVC-PAGWKPGSDT-IKPDVNK 190

  Fly   192 EEAH 195
            .:.:
  Rat   191 SKEY 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-1NP_724931.1 AhpC 1..194 CDD:223527 64/196 (33%)
PRX_1cys 3..218 CDD:239314 64/198 (32%)
Prdx1NP_476455.1 PRX_Typ2cys 8..180 CDD:239313 59/181 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.