DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA29a and CheA56a

DIOPT Version :9

Sequence 1:NP_788004.1 Gene:CheA29a / 246659 FlyBaseID:FBgn0053194 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027438.1 Gene:CheA56a / 3772206 FlyBaseID:FBgn0262595 Length:180 Species:Drosophila melanogaster


Alignment Length:177 Identity:72/177 - (40%)
Similarity:113/177 - (63%) Gaps:11/177 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKVFLILWTVSQVYIPCWGKK---FISRFESINGIEGEKETLFTCSVRLVGRERMLNGSIMHQVD 67
            ::..|||||||.      |.|   :..|||||:.::|..||||...:||:||.||:||:::...|
  Fly     7 IQSLLILWTVSV------GSKKSNYEVRFESIDAVKGSTETLFLYQLRLLGRNRMINGTLIFLED 65

  Fly    68 LDDSFDVWMDILHFKNGEWAQGNIK-VRTKPCDWFTNYFGKYFLPLVKDSNLPPI-QEMCVFPKG 130
            ||::|||..:...||||.|.:|.:. ..:|||::|..|:..:||....:||||.. .|||.|.||
  Fly    66 LDETFDVLFESHAFKNGYWVKGIVNAAASKPCEFFNRYYISFFLVKSTESNLPTTGAEMCPFRKG 130

  Fly   131 EYYLRITKIEPQNWPPILYRGLNQFNINYVRDGKSTGGIQFVIDLED 177
            .|:::...:..::||||:::|||:|.|:|:::|:..||:|..|.:.:
  Fly   131 TYFVKNGVVSTEDWPPIVFKGLNRFTISYLKNGECVGGVQLTISIAE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA29aNP_788004.1 None
CheA56aNP_001027438.1 DUF1091 97..179 CDD:301369 31/81 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 1 1.000 - - otm74819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.