DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA29a and CG18539

DIOPT Version :9

Sequence 1:NP_788004.1 Gene:CheA29a / 246659 FlyBaseID:FBgn0053194 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster


Alignment Length:158 Identity:29/158 - (18%)
Similarity:56/158 - (35%) Gaps:30/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ETLFTCSVRLVGRERMLNGSIMHQVDLDDSFD------VWMDILHFKNGEWAQGNIKVRTKPCDW 100
            |:|...:.::   :|:........:.||.::|      |..|:.|..:|:.....:...:.|...
  Fly    39 ESLLKITTKI---DRLGRSDYAFSMTLDWNYDVDKDTMVEADVHHCSSGDEDDYKMMPWSIPKQP 100

  Fly   101 FTNYF-GKYFLPLVKD----SNL--------PPIQEMCVFPKGEYYLRITKIEPQNWPPILYRGL 152
            |..|. |.|....:|:    ||:        ||      :|:..|.|.......:..|.|...|.
  Fly   101 FFEYLNGFYKDAFIKNVGHCSNMVQFDGDFVPP------WPRNVYKLDKCVASGEGLPDIAPEGF 159

  Fly   153 NQFNINYVRDGKSTGGIQFVIDLEDSTL 180
              :.:.|...|:...|...::.:....:
  Fly   160 --YKLEYKMTGQVDWGFTLIVKVSPKVI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA29aNP_788004.1 None
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 16/84 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.