DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA29a and CG14502

DIOPT Version :9

Sequence 1:NP_788004.1 Gene:CheA29a / 246659 FlyBaseID:FBgn0053194 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001163192.1 Gene:CG14502 / 37092 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster


Alignment Length:174 Identity:41/174 - (23%)
Similarity:71/174 - (40%) Gaps:43/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILWTVSQVYIPCWGKKFISRFESINGIE----GEKETLFTCSVRLVGR-ERMLNGSIMHQVDLD 69
            |||..|.|    |.||:... :|.:: ||    .|.:......|..||| |..|:|:|..:...:
  Fly    14 LILLIVDQ----CNGKRKWD-YEPLS-IETYTTDETKLKIAAKVERVGRGEYALSGNIEFKYTPE 72

  Fly    70 DSFDVWMDILHFKNGEWAQGNIKV------RTKPCDWFTNYFGKYFLPLVKD-SNL--------P 119
            |  :..::.:.:::....:.:.|:      :....::..:::....||.:.| |||        |
  Fly    73 D--NTMVEAMAYRSTSGDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSNLIKFDGKFEP 135

  Fly   120 P------IQEMCV---------FPKGEYYLRITKIEPQNWPPIL 148
            |      :.|.||         .|:|.|.:..|...|.:|..||
  Fly   136 PWPQDTYVLEKCVANSDGFPDMVPEGYYKVNFTLTNPVDWGFIL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA29aNP_788004.1 None
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.