DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA29a and CheA7a

DIOPT Version :9

Sequence 1:NP_788004.1 Gene:CheA29a / 246659 FlyBaseID:FBgn0053194 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_572395.2 Gene:CheA7a / 31672 FlyBaseID:FBgn0029948 Length:177 Species:Drosophila melanogaster


Alignment Length:108 Identity:28/108 - (25%)
Similarity:51/108 - (47%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TCSVRLVGRER-MLNGSIMHQVDLDDSFDVWMDILHFKNGEWAQGNIKVRTKP--CDWFTNYFGK 107
            |.|::.|.|.: :::|....::::.|...:.:.:..:.:....:|::.:..|.  |.:.......
  Fly    46 TLSMKKVSRNQFVVSGDFEFKLNMADEQKIVLMVYVYDSNANQRGSMVMAVKKPFCQFIKEDEDS 110

  Fly   108 YFLPLV-KDSNLPPIQEMCVFPKGEY----YLRITKIEPQNWP 145
            |  |.: |.||||. |:.|.||||:|    |...|...|.|.|
  Fly   111 Y--PSIQKASNLPD-QDTCPFPKGKYTIDNYELETNFLPDNAP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA29aNP_788004.1 None
CheA7aNP_572395.2 DM8 89..177 CDD:214778 22/65 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.