DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA29a and LOC11176035

DIOPT Version :10

Sequence 1:NP_788004.1 Gene:CheA29a / 246659 FlyBaseID:FBgn0053194 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_003436265.2 Gene:LOC11176035 / 11176035 VectorBaseID:AGAMI1_012728 Length:230 Species:Anopheles gambiae


Alignment Length:131 Identity:29/131 - (22%)
Similarity:56/131 - (42%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RFESINGIEGEKETLFTCSVRLVGRERML---NGSIMHQVDLDD--SFDVWMDILHFKNGEWAQG 89
            ||:..||    .:.:...::|:....|.|   :|:.....|:||  :|.|.:......|.::.:.
Mosquito    76 RFQQNNG----TDLIDAANLRIRKYNRTLTVFDGTFELYRDMDDDYAFSVSLSYSTLGNNQFIRS 136

  Fly    90 NIKV-RTKPCDWFTNYFGKYFLPLVKDSNLPPIQEMCVFPKGEYYLR----ITKIEPQNWPPILY 149
            ..:: :...|.:|...:..|.......:|||.: ..|..|..:||:|    .:|:....:.|.|:
Mosquito   137 PFRLPQQHVCTFFNTTYRDYREFYRNVTNLPDV-GTCPMPAQQYYIRNKVLDSKLINNYFQPGLW 200

  Fly   150 R 150
            |
Mosquito   201 R 201

Return to query results.
Submit another query.