DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46385 and TENT5A

DIOPT Version :9

Sequence 1:NP_001356959.1 Gene:CG46385 / 246653 FlyBaseID:FBgn0286778 Length:1107 Species:Drosophila melanogaster
Sequence 2:NP_060103.2 Gene:TENT5A / 55603 HGNCID:18345 Length:442 Species:Homo sapiens


Alignment Length:383 Identity:215/383 - (56%)
Similarity:260/383 - (67%) Gaps:28/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 PPSPSSGSSIASTSDHGSLESVDTGG---------------TQRLAVLSFEQVSKLHDVMDEKVA 417
            |..|..|.........|.....|.||               |....||::|||.:|..::.|.:.
Human    19 PYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETIP 83

  Fly   418 IHGRGNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVLASED-QPYNDLDL 481
            |||||||||||::...:|.:|||:| ||...|     |:|:||||.||||||..:. ..|.||||
Human    84 IHGRGNFPTLELQPSLIVKVVRRRL-AEKRIG-----VRDVRLNGSAASHVLHQDSGLGYKDLDL 142

  Fly   482 IFAIELSSPRVFDRVKVAVLNTLLDLMPEGVCKRRIYTCSLKEAYVGKMVKVNNNNDGDRWSLIS 546
            ||..:|.....|..||..||:.|||.:||||.|.:|...:||||||.|||||  .||.|||||||
Human   143 IFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKV--CNDSDRWSLIS 205

  Fly   547 LGNSPGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFYDCAALPISENFYPTVVGESVYGDFQ 611
            |.|:.| |||||||||::|||||||||||||.||||||||:|:..|::|.|:||::|||||||||
Human   206 LSNNSG-KNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFQ 269

  Fly   612 EALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQT 676
            ||..||..|:|:||.||||||||||||||||||.::....: ||||:|||||||||||.||..|.
Human   270 EAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASDE-IKTLQRYMCSRFFIDFSDIGEQQ 333

  Fly   677 TKLEAYLRNHFWGVDEEPLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQVL 734
            .|||:||:|||.|:::.  :|:|||.|..||..||||||||||||:|:||..||.:||
Human   334 RKLESYLQNHFVGLEDR--KYEYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46385NP_001356959.1 NTP_transf_7 400..727 CDD:311785 201/327 (61%)
TENT5ANP_060103.2 Repetitive region 24..28 1/3 (33%)
Repetitive region 29..33 0/3 (0%)
Repetitive region 34..38 1/3 (33%)
Repetitive region 39..43 1/3 (33%)
NTP_transf_7 66..383 CDD:311785 202/328 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140626
Domainoid 1 1.000 385 1.000 Domainoid score I814
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000843
OrthoInspector 1 1.000 - - otm40658
orthoMCL 1 0.900 - - OOG6_104729
Panther 1 1.100 - - O PTHR12974
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X528
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.