DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46385 and tent5a

DIOPT Version :9

Sequence 1:NP_001356959.1 Gene:CG46385 / 246653 FlyBaseID:FBgn0286778 Length:1107 Species:Drosophila melanogaster
Sequence 2:XP_002938504.1 Gene:tent5a / 100490270 XenbaseID:XB-GENE-5843475 Length:402 Species:Xenopus tropicalis


Alignment Length:357 Identity:209/357 - (58%)
Similarity:258/357 - (72%) Gaps:16/357 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 DHGSLESVDTGG--TQRLAVLSFEQVSKLHDVMDEKVAIHGRGNFPTLEVKLKDLVNLVRRKLEA 444
            :|.:...:.||.  :....|||:|||.:|..::.|.:.|||||||||||:|...:|.:||.:||.
 Frog     5 EHSNPSGICTGSCDSANCNVLSWEQVQRLDAILTETIPIHGRGNFPTLEMKPSQIVKVVRSRLEE 69

  Fly   445 EVNAGGAGVLVKDIRLNGGAASHVLASEDQ--PYNDLDLIFAIELSSPRVFDRVKVAVLNTLLDL 507
            :      |:.|:|:||||.||||:| .||.  .|.||||||..:|.....|..||..||:.|||.
 Frog    70 K------GIRVRDVRLNGSAASHIL-HEDSGLGYKDLDLIFCTDLRGEAEFQTVKDVVLDCLLDF 127

  Fly   508 MPEGVCKRRIYTCSLKEAYVGKMVKVNNNNDGDRWSLISLGNSPGHKNVELKFVDTMRRQFEFSV 572
            :||||.|.:|...:||||||.|||||  .||.||||||||.|:.| |||||||:|::||||||||
 Frog   128 LPEGVNKEKITPLTLKEAYVQKMVKV--CNDSDRWSLISLSNNHG-KNVELKFMDSLRRQFEFSV 189

  Fly   573 DSFQIVLDSLLLFYDCAALPISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLK 637
            |||||.||||||||:|:..|::|.|:||::|||||||||||..||..|:|:||.|||||||||||
 Frog   190 DSFQIKLDSLLLFYECSQNPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLK 254

  Fly   638 YCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEEPLQYQYLMH 702
            |||||||.::|.....:|:|:|||||||||||.||..|..|||:||:|||.|:::.  :|.|||.
 Frog   255 YCNLLVRGFRAASETEMKSLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDR--KYDYLMT 317

  Fly   703 LREVVEMSTVCLMGHERRQSLHLIQSLAAQVL 734
            |..||..||||||||||||:|.||..||.:||
 Frog   318 LHGVVNESTVCLMGHERRQTLSLITMLAIRVL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46385NP_001356959.1 NTP_transf_7 400..727 CDD:311785 200/328 (61%)
tent5aXP_002938504.1 NTP_transf_7 25..343 CDD:369633 201/329 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 382 1.000 Domainoid score I826
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000843
OrthoInspector 1 1.000 - - otm47836
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X528
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.