DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46385 and tent5c

DIOPT Version :10

Sequence 1:NP_001356959.1 Gene:CG46385 / 246653 FlyBaseID:FBgn0286778 Length:1107 Species:Drosophila melanogaster
Sequence 2:XP_002943490.1 Gene:tent5c / 100379867 XenbaseID:XB-GENE-5913838 Length:393 Species:Xenopus tropicalis


Alignment Length:42 Identity:14/42 - (33%)
Similarity:16/42 - (38%) Gaps:13/42 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NADTYGFQPQGAHLPV--EPPVPDHVLKSLEEIRANPPRDQE 132
            |...|.:.| |.|||:  |||          ..|...||..|
 Frog    48 NDPGYMYTP-GQHLPLRGEPP----------SSRIRSPRGGE 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46385NP_001356959.1 NTP_transf_7 400..727 CDD:462329
tent5cXP_002943490.1 NTP_transf_7 19..336 CDD:462329 14/42 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.