DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and CBR3

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001227.1 Gene:CBR3 / 874 HGNCID:1549 Length:277 Species:Homo sapiens


Alignment Length:296 Identity:78/296 - (26%)
Similarity:122/296 - (41%) Gaps:71/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KVAIVTGGNTGLGKETVMELARR-GATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLD 109
            :||:|||.|.|:|.....||.|: ...|.:..|:..:.:.|.:::..| |.|..| .:.|:..|.
Human     6 RVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAE-GLSPRF-HQLDIDDLQ 68

  Fly   110 SIRKFAENFKKEQRVLHILINNAGVFWE-----PHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLE 169
            |||...:..:||...|::|:|||.|.::     |..:..   ||.|..|......:.|.||.:::
Human    69 SIRALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKA---EMTLKTNFFATRNMCNELLPIMK 130

  Fly   170 RSAPSRVVVVAS----RAHE------RGQIKVDDINSSDFYD----------------EG---VA 205
              ...|||.::|    ||.|      :.:...:.:...|..|                ||   ..
Human   131 --PHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGWPNSP 193

  Fly   206 YCQSKLANILFTRELAKRLE----GTGVTVNALNPGIADTEI-ARNMIFFQTKFAQYVVETILRP 265
            |..|||...:.:|.||:||:    ...:.|||..||...|:: .::.|                 
Human   194 YGVSKLGVTVLSRILARRLDEKRKADRILVNACCPGPVKTDMDGKDSI----------------- 241

  Fly   266 LLWAVMKTPKNGAQTTLY-AALDPDLERVSGQYFSD 300
                  :|.:.||:|.:| |.|.||.....||...|
Human   242 ------RTVEEGAETPVYLALLPPDATEPQGQLVHD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 75/290 (26%)
NADB_Rossmann 45..323 CDD:304358 78/296 (26%)
CBR3NP_001227.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 78/296 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.