DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and YKL107W

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_012815.1 Gene:YKL107W / 853753 SGDID:S000001590 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:72/291 - (24%)
Similarity:121/291 - (41%) Gaps:24/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLDSI 111
            |||: ||..|||:....|||:|.|.|.:.      .:..|.|.:|:..|   |.: .|||.:...
Yeast    26 VAII-GGTGGLGRAISRELAQRNARVTVV------GQTFRDEDLKDKIN---FVK-ADLSLVSEC 79

  Fly   112 RKFAENFKKEQRVLHILINNAGVFWEPHR-LTKEGFEMHLGVNHIGHFLLTNLL---LGVLERSA 172
            ::.:.:.:.....|..||...|:|....| .|.||.|..:.|:::..:::.:.:   ||:.....
Yeast    80 KRISHSDEIPYEELTHLIFTTGIFASRQRQATSEGLEKDMAVSYLSRYIIFHDVAKRLGISRTKK 144

  Fly   173 PSRVVVVASRAHERGQI-KVDDINSSD-FYDEGVAYCQSKLANILFTRELAKRLEGTGVTVNALN 235
            .....|..:.....||: ..||:||.: .|.....:..:..||.....:...|.  |.:....||
Yeast   145 DDLPKVFIAGFPGNGQVGDPDDLNSDEKKYSAYATHMNTVAANESLVIDAKDRY--TNIDTFGLN 207

  Fly   236 PGIADTEIARNMIFFQTKFAQYVVETILRPLLWAVMKTPKNGAQTTLYAALDPDLERVSGQYFSD 300
            ||:..|.|..|::...| :...:.|.|:.   | ..::.:..|:|.......|.:|..||..||:
Yeast   208 PGLIKTNIRNNLLGSDT-YLSRITEWIIS---W-TCQSAETYAKTICTLIASPAIESRSGTMFSN 267

  Fly   301 CALAPVAPAALDDQMAQWLWAQSEKWAKIAL 331
            ...|.:....|...:.:.....||...:.||
Yeast   268 KGDAILPSPGLTKDVVEKFMENSELLVEKAL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 63/254 (25%)
NADB_Rossmann 45..323 CDD:304358 68/281 (24%)
YKL107WNP_012815.1 NADB_Rossmann 26..285 CDD:419666 68/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.