DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and AT5G50130

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_568721.1 Gene:AT5G50130 / 835078 AraportID:AT5G50130 Length:339 Species:Arabidopsis thaliana


Alignment Length:291 Identity:101/291 - (34%)
Similarity:154/291 - (52%) Gaps:27/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLDSIR 112
            ||:|||.:|:|.||...||:||..|.||.|:.:|.|..:..|::|...:::...|.|||||.|:.
plant    39 AIITGGTSGIGAETARVLAKRGVRVVMAVRDMKKAEMVKERIIRENPEADIILFEIDLSSLSSVA 103

  Fly   113 KFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLL----LGVLERSA- 172
            :|...|..:...|:|||||||||......::|..|:....|.:||:|||.:|    :...|:|. 
plant   104 RFCSQFLSQDLPLNILINNAGVFSPNLEFSEEKIELTFATNFLGHYLLTEMLIEKMIDTAEKSGI 168

  Fly   173 PSRVVVVASRAHERGQIKVDD------INSSDFYDEGVAYCQSKLANILFTRELAKRLE--GTGV 229
            ..|::.::|..|  ..:|.|.      ::....|:...||.|||||.||..:.|:|:|:  ...|
plant   169 EGRIINLSSVIH--NWVKPDCFSFPKLLHPISRYNGTRAYAQSKLATILHAKALSKQLKDRNANV 231

  Fly   230 TVNALNPGIADTEI--ARNMIFFQTKFAQYVVETILRPLLWAVMKTPKNGAQTTLYAALDPDLER 292
            |:||::|||..|.|  |...:|..:.|.          :...::|:...||.||.|.||..:.:.
plant   232 TINAVHPGIVKTGIIRAHKGLFTDSLFL----------IASKLLKSISQGAATTCYVALSNETKG 286

  Fly   293 VSGQYFSDCALAPVAPAALDDQMAQWLWAQS 323
            :||:||:||.....:..|.|:.:|..|..||
plant   287 LSGKYFADCNETNCSDLANDEYVALKLCTQS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 90/262 (34%)
NADB_Rossmann 45..323 CDD:304358 99/289 (34%)
AT5G50130NP_568721.1 retinol-DH_like_SDR_c_like 38..313 CDD:212492 98/285 (34%)
adh_short 38..245 CDD:278532 77/207 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.