DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and AT2G37540

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_181290.1 Gene:AT2G37540 / 818330 AraportID:AT2G37540 Length:321 Species:Arabidopsis thaliana


Alignment Length:290 Identity:112/290 - (38%)
Similarity:160/290 - (55%) Gaps:21/290 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DETGKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLS 106
            |.:...||:|||.:|:|.|....||.|||.|.:|.||.:....::..|::...|:.|...:.|:|
plant    30 DASHLTAIITGGTSGIGLEAARVLAMRGAHVIIAARNPKAANESKEMILQMNPNARVDYLQIDVS 94

  Fly   107 SLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERS 171
            |:.|:|.|.:.|......|:||||||||.:.|.:||::|.|.....|||||||||||||..::.:
plant    95 SIKSVRSFVDQFLALNVPLNILINNAGVMFCPFKLTEDGIESQFATNHIGHFLLTNLLLDKMKST 159

  Fly   172 A-----PSRVVVVASRAH----ERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRL--E 225
            |     ..|:|.::|.||    ..| ||...||....|.|..||.||||:|:|.:..|::||  |
plant   160 ARESGVQGRIVNLSSIAHTYTYSEG-IKFQGINDPAGYSERRAYGQSKLSNLLHSNALSRRLQEE 223

  Fly   226 GTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPLLWAVMKTPKNGAQTTLYAALDPDL 290
            |..:|:|:::||:..|.:.|...|....|         |.:.:...|....||.||.|.||.|||
plant   224 GVNITINSVHPGLVTTNLFRYSGFSMKVF---------RAMTFLFWKNIPQGAATTCYVALHPDL 279

  Fly   291 ERVSGQYFSDCALAPVAPAALDDQMAQWLW 320
            |.|:|:||.||.:...:..|.::.:|..||
plant   280 EGVTGKYFGDCNIVAPSKFATNNSLADKLW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 102/262 (39%)
NADB_Rossmann 45..323 CDD:304358 111/287 (39%)
AT2G37540NP_181290.1 retinol-DH_like_SDR_c_like 35..309 CDD:212492 109/283 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 171 1.000 Domainoid score I1148
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100724
Inparanoid 1 1.050 219 1.000 Inparanoid score I1212
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.