DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and DHRS12

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001364858.1 Gene:DHRS12 / 79758 HGNCID:25832 Length:320 Species:Homo sapiens


Alignment Length:204 Identity:80/204 - (39%)
Similarity:123/204 - (60%) Gaps:16/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLD 109
            |:|.:|||||:|:||.|.:|:|:||.||::.||::...|.||.||::|:||.|:|....|||...
Human    40 GRVFLVTGGNSGIGKATALEIAKRGGTVHLVCRDQAPAEDARGEIIRESGNQNIFLHIVDLSDPK 104

  Fly   110 SIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPS 174
            .|.||.||||:|.: ||:||||||.......||::|.|.:...|.:|.::||..|:.|||:....
Human   105 QIWKFVENFKQEHK-LHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDP 168

  Fly   175 RVVVVASRAHERGQIKVDDINSSDF------YDEGVAYCQSKLANILFTRELAKRLEG-TGVTVN 232
            ||:.|:|     |.:.|..:|::|.      :|..:.|.|:|...::.|...|   :| ..:..:
Human   169 RVITVSS-----GGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWA---QGHPAIHFS 225

  Fly   233 ALNPGIADT 241
            :::||.|||
Human   226 SMHPGWADT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 80/204 (39%)
NADB_Rossmann 45..323 CDD:304358 80/204 (39%)
DHRS12NP_001364858.1 NADB_Rossmann 40..>235 CDD:419666 80/204 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.