Sequence 1: | NP_001260785.1 | Gene: | CG30495 / 246651 | FlyBaseID: | FBgn0050495 | Length: | 331 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001364858.1 | Gene: | DHRS12 / 79758 | HGNCID: | 25832 | Length: | 320 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 80/204 - (39%) |
---|---|---|---|
Similarity: | 123/204 - (60%) | Gaps: | 16/204 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 GKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLD 109
Fly 110 SIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPS 174
Fly 175 RVVVVASRAHERGQIKVDDINSSDF------YDEGVAYCQSKLANILFTRELAKRLEG-TGVTVN 232
Fly 233 ALNPGIADT 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30495 | NP_001260785.1 | FabG | 44..296 | CDD:223959 | 80/204 (39%) |
NADB_Rossmann | 45..323 | CDD:304358 | 80/204 (39%) | ||
DHRS12 | NP_001364858.1 | NADB_Rossmann | 40..>235 | CDD:419666 | 80/204 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1208 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |