DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and Dhrs13

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_899109.2 Gene:Dhrs13 / 70451 MGIID:1917701 Length:376 Species:Mus musculus


Alignment Length:294 Identity:133/294 - (45%)
Similarity:186/294 - (63%) Gaps:23/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLD 109
            |:..:|||.|:|:||.|.:|||||||.|.:|||::|:.|.|..::.:|:||:.|.....||:||.
Mouse    36 GRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLA 100

  Fly   110 SIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPS 174
            |::.||..|...:..|.:||:|||:  .....|:|.|.:.|.|||:|.||||:|||..|...|||
Mouse   101 SVQAFATAFLSSEPRLDVLIHNAGI--SSCGRTRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPS 163

  Fly   175 RVVVVASRAHERGQIKVDDINSSD-----FYDEGVAYCQSKLANILFTRELAKRLEGTGVTVNAL 234
            |||:|:|.||.||::   |....|     :..|..||..|||||:||.||||.:|||||||..|.
Mouse   164 RVVIVSSAAHRRGRL---DFTRLDCPVVGWQQELRAYADSKLANVLFARELATQLEGTGVTCYAA 225

  Fly   235 NPGIADTEIARNMIFFQTKFAQYV---VETILRPLLWAVMKTPKNGAQTTLYAALDPDLERVSGQ 296
            :||..::|:          |.:::   :..|||||.|.|::.|:.||||.||.||...:|.:||:
Mouse   226 HPGPVNSEL----------FLRHLPGWLRPILRPLAWLVLRAPQGGAQTPLYCALQEGIEPLSGR 280

  Fly   297 YFSDCALAPVAPAALDDQMAQWLWAQSEKWAKIA 330
            ||::|.:..|:|||.|||.||.||..::|.|.:|
Mouse   281 YFANCHVEEVSPAARDDQAAQRLWKATKKLAGLA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 115/258 (45%)
NADB_Rossmann 45..323 CDD:304358 130/285 (46%)
Dhrs13NP_899109.2 PRK06197 31..312 CDD:235737 131/290 (45%)
retinol-DH_like_SDR_c_like 36..304 CDD:212492 128/282 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..376 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.