DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and dhrs12la

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_987120.1 Gene:dhrs12la / 677747 ZFINID:ZDB-GENE-030131-8104 Length:320 Species:Danio rerio


Alignment Length:290 Identity:89/290 - (30%)
Similarity:147/290 - (50%) Gaps:35/290 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QTDETGKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECD 104
            :|...|:..::||.|:|:||...|.:|::|.||:|.||||:|.|.||.|||||:||..::....|
Zfish    35 ETSMAGRSFMITGANSGIGKAAAMAIAKKGGTVHMVCRNKDKAEEARAEIVKESGNKEIYVHILD 99

  Fly   105 LSSLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLE 169
            ||....:.:|.|:|||:.:.|::||||||.......:..||.|.....|.:..|:....|:.:||
Zfish   100 LSETKKVWEFVESFKKKYKTLNVLINNAGCMMTKREVNGEGLEKSFASNSLAVFIFIKSLIPLLE 164

  Fly   170 RSAPSRVVVVASRAHERGQIKVDDINSSDF------YDEGVAYCQSKLANILFTRELAKRLEGTG 228
            :|...||:.|:|     |.:.|..:.:.:.      ||..:.|.|:|...::.|.:.||  ....
Zfish   165 KSPDPRVITVSS-----GGMLVQKLRTGNLQSQRGRYDGTMVYAQNKRQQVVMTEQFAK--AHPS 222

  Fly   229 VTVNALNPGIADT-EIARNMIFFQTKFAQYVVETILRPLLWAVMKTPKNGAQTTLYAAL-DPDLE 291
            :..:.::||..|| .||..|..|.:...:.             ::|.:.||.|.::.|: :...:
Zfish   223 IHFSVMHPGWVDTPTIANAMPDFHSSMKER-------------LRTTEQGADTVVWLAVSEAAAK 274

  Fly   292 RVSGQYFSD----CALAPVA---PAALDDQ 314
            ..||:::.|    .|..|:|   .:.|:||
Zfish   275 NPSGRFYQDRKMVSAHLPLAWTHSSQLEDQ 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 80/259 (31%)
NADB_Rossmann 45..323 CDD:304358 88/285 (31%)
dhrs12laNP_987120.1 FabG 37..273 CDD:223959 79/255 (31%)
DHRS-12_like_SDR_c-like 40..294 CDD:187668 84/273 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.