DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and rdh14

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001017231.1 Gene:rdh14 / 549985 XenbaseID:XB-GENE-1018384 Length:323 Species:Xenopus tropicalis


Alignment Length:285 Identity:135/285 - (47%)
Similarity:187/285 - (65%) Gaps:15/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETG-NSNVFSRECDLSSL 108
            ||..|:||.|.|:||.|..||.::.|.|.:|||::.:.|.|..|:.:|.| ...:..::.||.||
 Frog    42 GKTVIITGANCGIGKATAAELVKQEARVILACRDQGRAEEAAAELRREAGERGEIVIKQLDLGSL 106

  Fly   109 DSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAP 173
            .|:|:|.:...||:..|.:||||||||..|:..|::||||..||||:||||||:.|||:|:.|||
 Frog   107 QSVRRFCQEVLKEEPRLDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTHHLLGLLKSSAP 171

  Fly   174 SRVVVVASRAHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRLEGTGVTVNALNPGI 238
            ||:|||:|:.::.|:|..||:||...|.....|.:|||||||||||||.||||||||||||:|||
 Frog   172 SRIVVVSSKLYKYGEINFDDLNSEKSYSRSFGYSRSKLANILFTRELASRLEGTGVTVNALHPGI 236

  Fly   239 ADTEIARNMIFFQTKFAQYVVETILRPLL----WAVMKTPKNGAQTTLYAALDPDLERVSGQYFS 299
            ..|.:.|::          .:..:::||.    ||..|:|:.||||::|.|..|::|.|||.||.
 Frog   237 VRTNLGRHI----------NIPILIKPLFNVVSWAFFKSPEEGAQTSIYLASSPEVEGVSGSYFG 291

  Fly   300 DCALAPVAPAALDDQMAQWLWAQSE 324
            :.....:.|.|:||.:|:.||..||
 Frog   292 NSKEEELLPKAMDDLVARKLWDISE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 123/255 (48%)
NADB_Rossmann 45..323 CDD:304358 133/282 (47%)
rdh14NP_001017231.1 NADB_Rossmann 42..315 CDD:389744 133/282 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.