DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and Rdh14

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001102746.1 Gene:Rdh14 / 500629 RGDID:1565196 Length:334 Species:Rattus norvegicus


Alignment Length:334 Identity:146/334 - (43%)
Similarity:201/334 - (60%) Gaps:30/334 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SIAPVFLAHGIVGIIAFCVRLYMQGGKFRKQTDET-----GKVAIVTGGNTGLGKETVMELARRG 69
            |:|...|| .:.|.:....|.:......|:|....     ||..::||.|:|||:.|..||.|.|
  Rat     5 SVAAALLA-ALGGALWLAARRFSGSSGQRRQGGGDPGLMHGKTVLITGANSGLGRATAGELLRLG 68

  Fly    70 ATVYMACRNKEKVERARREIVKETG----------NSNVFSRECDLSSLDSIRKFAENFKKEQRV 124
            |.|.|.||::.:.|.|..::.:|.|          :..:..:|.||:||.|:|.|.:...:|:..
  Rat    69 ARVIMGCRDRARAEEAAGQLRQELGQAGGLGPDATDGQLVVKELDLASLRSVRAFCQELLQEEPR 133

  Fly   125 LHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPSRVVVVASRAHERGQI 189
            |.:||||||||..|:..|::||||..||||:|||||||||||:|:.|||||:|||:|:.::.|.|
  Rat   134 LDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDI 198

  Fly   190 KVDDINSSDFYDEGVAYCQSKLANILFTRELAKRLEGTGVTVNALNPGIADTEIARNMIFFQTKF 254
            ..:|:||...|::...|.:|||||||||||||.|||||.||||.|:|||..|.:.|::       
  Rat   199 NFEDLNSEQSYNKSFCYSRSKLANILFTRELAHRLEGTNVTVNVLHPGIVRTNLGRHI------- 256

  Fly   255 AQYVVETILRPLL----WAVMKTPKNGAQTTLYAALDPDLERVSGQYFSDCALAPVAPAALDDQM 315
               .:..:.|||.    ||..|||..||||::|.|..||:|.|||:||.||....:.|.|:|:.:
  Rat   257 ---HIPLLARPLFNLVSWAFFKTPLEGAQTSIYLASSPDVEGVSGRYFGDCKEEELLPKAMDESV 318

  Fly   316 AQWLWAQSE 324
            |:.||..||
  Rat   319 ARKLWDISE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 125/270 (46%)
NADB_Rossmann 45..323 CDD:304358 136/291 (47%)
Rdh14NP_001102746.1 PRK06197 43..332 CDD:235737 138/295 (47%)
NADB_Rossmann 44..326 CDD:304358 136/291 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9026
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.