DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and rdh13

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001011000.1 Gene:rdh13 / 496409 XenbaseID:XB-GENE-965068 Length:329 Species:Xenopus tropicalis


Alignment Length:302 Identity:145/302 - (48%)
Similarity:198/302 - (65%) Gaps:5/302 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AFCVRLYMQGGKFRKQTDETGKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREI 89
            |..::.|..||....:....|:..||||.|||:||||.:|||:||..:.||||:..|.|.|.|:|
 Frog    18 AILLKDYTGGGNCPSKASIIGQTVIVTGANTGIGKETALELAKRGGRIIMACRDMGKCENAARDI 82

  Fly    90 VKETGNSNVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNH 154
            ..:|.|.|||:|..||:|..||::||:....|:..:.:|||||.|...||..|::.|||..||||
 Frog    83 RGKTLNHNVFARHLDLASSKSIKEFAKTIINEEERVDVLINNAAVMRCPHWKTEDNFEMQFGVNH 147

  Fly   155 IGHFLLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDDIN-SSDFYDEGVAYCQSKLANILFTR 218
            :||||||||||..::||..||::.|:|.||..|.|..||:| ....|:...|||||||||:|||.
 Frog   148 LGHFLLTNLLLEKMKRSENSRIINVSSLAHIAGDIDFDDLNWEKKKYNTKAAYCQSKLANVLFTN 212

  Fly   219 ELAKRLEGTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPLLWAVMKTPKNGAQTTLY 283
            ||||||:||.:|.|:|:||:||||:.|:....|:.|:    .|||.||.|.::|:||..||.::|
 Frog   213 ELAKRLQGTKLTANSLHPGVADTELGRHTGMHQSAFS----STILAPLFWFLVKSPKQAAQPSVY 273

  Fly   284 AALDPDLERVSGQYFSDCALAPVAPAALDDQMAQWLWAQSEK 325
            .|:..:|:.|||:||:.......||.|||::.|:.||.:|.|
 Frog   274 LAVAENLQGVSGKYFNALKEKEPAPQALDEESARKLWEESAK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 128/252 (51%)
NADB_Rossmann 45..323 CDD:304358 139/278 (50%)
rdh13NP_001011000.1 retinol-DH_like_SDR_c 38..313 CDD:212495 139/278 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 243 1.000 Domainoid score I2166
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 314 1.000 Inparanoid score I2520
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm48536
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.