DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and rdh12l

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001009912.1 Gene:rdh12l / 494176 ZFINID:ZDB-GENE-040801-48 Length:291 Species:Danio rerio


Alignment Length:279 Identity:145/279 - (51%)
Similarity:194/279 - (69%) Gaps:9/279 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLD 109
            ||..::||.|||:||||.::||:|||.:.||||:.||.|.|.:|:...:||.:||....|||...
Zfish    13 GKTVLITGANTGIGKETAIDLAKRGARIIMACRDMEKAEAALKEVKDSSGNQDVFISSLDLSDSK 77

  Fly   110 SIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPS 174
            |||.|||...||::.::||||||||...|:..|.:||||.:||||:||||||.|||.:::||||:
Zfish    78 SIRGFAEKINKEEKQVNILINNAGVMVCPYGKTADGFEMQIGVNHMGHFLLTYLLLDLIKRSAPA 142

  Fly   175 RVVVVASRAHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRLEGTGVTVNALNPGIA 239
            |::.|:|.||:.|.|.::||||...||:..|||||||||:||||.|||||||||||..:|:||:.
Zfish   143 RIINVSSTAHQWGTINLEDINSEKNYDKQKAYCQSKLANVLFTRSLAKRLEGTGVTAYSLHPGVV 207

  Fly   240 DTEIARNMIFFQTKFAQYVVETILRPLLWAVMKTPKNGAQTTLYAALDPDLERVSGQYFSDCALA 304
            .|::.|::     ...|..|....:|.    .||...||||::|.|:||.|:..||:|:||||.|
Zfish   208 QTDLWRHL-----SKPQQAVMWFTKPF----TKTSVQGAQTSIYCAVDPALQTESGKYYSDCAPA 263

  Fly   305 PVAPAALDDQMAQWLWAQS 323
            ..|.||:||::||.||..|
Zfish   264 KAAKAAMDDEVAQRLWELS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 128/250 (51%)
NADB_Rossmann 45..323 CDD:304358 144/277 (52%)
rdh12lNP_001009912.1 PRK06197 5..291 CDD:235737 145/279 (52%)
NADB_Rossmann 13..282 CDD:304358 144/277 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 254 1.000 Domainoid score I2017
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 304 1.000 Inparanoid score I2630
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.