DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and Dhrs4

DIOPT Version :10

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:Dhrs4 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:223 Identity:64/223 - (28%)
Similarity:99/223 - (44%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLD 109
            ||||:||....|:|......||..||.|.::.|.::.|:.|..|:.|.  |.||...:|.:|..:
  Fly    71 GKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKL--NLNVHGLKCHVSEPE 133

  Fly   110 SIRKFAENFKKEQRVLHILINNA-------GVFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGV 167
            ..::..|....:...|:||::||       ||.....::..:.|:    ||....:||....|.:
  Fly   134 DRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFD----VNVKSSYLLAKEALPL 194

  Fly   168 LERSAPSRVVVVASRAHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRLEGTGVTVN 232
            |.:...|.:|.|:|            |...|.::...||..||.|.|..|:..||.|...|:.||
  Fly   195 LRQQKNSSIVFVSS------------IAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVN 247

  Fly   233 ALNPGIADTEIARNMIFFQTKFAQYVVE 260
            .|.||:           .:|||::.:.|
  Fly   248 CLAPGV-----------IRTKFSKALYE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 Rossmann-fold NAD(P)(+)-binding proteins 45..323 CDD:473865 64/223 (29%)
Dhrs4NP_647946.1 Rossmann-fold NAD(P)(+)-binding proteins 67..317 CDD:473865 64/223 (29%)

Return to query results.
Submit another query.