DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and CG2070

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster


Alignment Length:318 Identity:196/318 - (61%)
Similarity:242/318 - (76%) Gaps:10/318 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LAHG----IVGIIAFCVRLYMQGGKFRKQTDETGKVAIVTGGNTGLGKETVMELARRGATVYMAC 76
            ||:|    .:||  :.:|.|||||:|..:|:|||:||||||.|.|:|||||:|||||||||||||
  Fly    12 LAYGSALSAIGI--YLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMAC 74

  Fly    77 RNKEKVERARREIVKETGNSNVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRL 141
            |:.:|.|.|||||:|.|.|.|:|:|:.||.|:.|||.||..||:||..|||||||||:...|..|
  Fly    75 RDMKKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKML 139

  Fly   142 TKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDDINSSDFYDEGVAY 206
            |::||||.:||||:||||||.|||.||:.||||||||::|.||..|:||.||:||...||..:||
  Fly   140 TEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMAY 204

  Fly   207 CQSKLANILFTRELAKRLEGTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPLLWAVM 271
            |||||||:||||||||||.|||||||||:||:.:||:.||..|..:.|.    :.::.|::|..:
  Fly   205 CQSKLANVLFTRELAKRLSGTGVTVNALHPGVVNTELFRNTPFLGSWFG----KLLIAPIIWIFI 265

  Fly   272 KTPKNGAQTTLYAALDPDLERVSGQYFSDCALAPVAPAALDDQMAQWLWAQSEKWAKI 329
            ||.:|||||||||||||.||:|||:|||||....|..||..|..||:|||:||||..|
  Fly   266 KTARNGAQTTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDDAQFLWAESEKWTGI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 162/251 (65%)
NADB_Rossmann 45..323 CDD:304358 176/277 (64%)
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 182/285 (64%)
NADB_Rossmann 43..317 CDD:304358 176/277 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448974
Domainoid 1 1.000 171 1.000 Domainoid score I1148
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 1 1.000 - - H100724
Inparanoid 1 1.050 219 1.000 Inparanoid score I1212
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm8848
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
1211.800

Return to query results.
Submit another query.