DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and CG13284

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:297 Identity:73/297 - (24%)
Similarity:119/297 - (40%) Gaps:65/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFL---AHGIVGIIAFCVRLYMQGGKFRKQTDETGKVAIVTGGNTGLGKETVMELARRGATVYMA 75
            |||   ...:|.||...:..|.|....|...|:.|:.|:|||...|:|||...||||:|..:.:.
  Fly    36 VFLYDNLKSLVSIIKAVLEPYFQPHLPRTLVDKFGQWAVVTGATDGIGKEYARELARQGINLVLI 100

  Fly    76 CRNKEKVERARREI-----VKETGNSNVFSR--------ECDLSSLDSIRKFAENFKKEQRVLHI 127
            .|.|||:.....||     ||....:..|::        |.:|:.:|               :.|
  Fly   101 SRTKEKLIAVTNEIESQYKVKTKWIAADFAKGREVYDQIEKELAGID---------------VGI 150

  Fly   128 LINNAGVFWE-PHRLTKEGFEMHLGVNHIGHFLLTNLL---LGVLERSAPSRVVVVASRAHERGQ 188
            |:||.|:.:| |..|           :.:...||.|||   :|.:  :..:|.::.......:|.
  Fly   151 LVNNVGMMYEHPESL-----------DLVSEDLLWNLLTVNMGSV--TMLTRKILPQMIGRRKGA 202

  Fly   189 IKVDDINSSDF--YDEGVAYCQSKLANILFTRELAKRLEGTGVTVNALNPGIADTE-------IA 244
            | |:..:||:.  ......|..||.....|::.|...:....:.|..:.|....|:       :.
  Fly   203 I-VNLGSSSELQPLPNMTVYAASKKFVTYFSKALELEVAEHNIHVQLVMPNFVVTKMNAYTDRVM 266

  Fly   245 RNMIFFQTKFAQYVVETILRPLLWAVMKTPK-NGAQT 280
            :..:||...:      |..|..::.:.||.: ||..|
  Fly   267 QGGLFFPNAY------TFARSAVFTLGKTSETNGFWT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 63/264 (24%)
NADB_Rossmann 45..323 CDD:304358 63/263 (24%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 63/263 (24%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 63/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.