DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and firl

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001033900.2 Gene:firl / 34627 FlyBaseID:FBgn0032405 Length:318 Species:Drosophila melanogaster


Alignment Length:221 Identity:49/221 - (22%)
Similarity:91/221 - (41%) Gaps:53/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEIVIRFLQSIAPVFLAHGIVGIIAFCVRLYMQGGKFRKQTDETGKVAIVTGGNTGLGKETVMEL 65
            :|:.:..:|.:.|                        :||.|.:|::.::||...|:|:|..:..
  Fly    35 LELFVSLVQIVLP------------------------KKQKDVSGEIVLITGTGHGIGRELALHY 75

  Fly    66 ARRGATVYMAC------RNKEKVERARREIVKETGNSNVFSRECDLSSLDSIRKFAENFKKEQRV 124
            |..|:||  .|      .|.:.||:|:|..:.|     |:|..||:|..|.:...|:..|.:...
  Fly    76 ASLGSTV--VCVDIDGKNNLQTVEKAKRLNLGE-----VYSYSCDVSKRDEVTALADRIKSDVGC 133

  Fly   125 LHILINNAGVFWEPHRL---TKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPSRVVVVASRAHER 186
            :.:|:||.|:. ..|.:   :.|..:....||....|......|..::......::.::|.|   
  Fly   134 ISVLVNNVGIM-PTHPILQQSAEEIQRVFDVNVFSQFWTIQAFLPHMQEKCRGHIICMSSIA--- 194

  Fly   187 GQIKVDDINSSDFYDEGVAYCQSKLA 212
            |.:.:.::         |.||.:|.|
  Fly   195 GLVGISNL---------VPYCATKFA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 43/178 (24%)
NADB_Rossmann 45..323 CDD:304358 43/177 (24%)
firlNP_001033900.2 adh_short 56..246 CDD:278532 42/176 (24%)
17beta-HSDXI-like_SDR_c 57..299 CDD:187598 42/175 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.