DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and cbr1l

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_919360.1 Gene:cbr1l / 337696 ZFINID:ZDB-GENE-030131-9642 Length:277 Species:Danio rerio


Alignment Length:287 Identity:76/287 - (26%)
Similarity:118/287 - (41%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KVAIVTGGNTGLGKETVMELARRGAT--VYMACRNKEKVERARREIVKETGNSNVFSRE---CDL 105
            |||:|||.|.|:|...|..|.:.|.|  :.:..||::..:.|...:..| |..||...:   ||.
Zfish     4 KVAVVTGANKGIGLAIVKGLCKAGFTGDILLTARNEKLGQEAIAGLQSE-GFKNVVFHQLDICDQ 67

  Fly   106 SSLDSIRKFAENFKKEQRVLHILINNAGVFW-----EPHRLTKEGFEMHLGVNHIGHFLLTNLLL 165
            .|...::||.|   ::...|.:||||||:.:     ||.   .|..|:.:..|..|.....:.||
Zfish    68 GSCMKLKKFLE---EKYGGLDVLINNAGIAFKNAATEPF---GEQAEVTMRTNFWGTLWACHALL 126

  Fly   166 GVLERSAPSRVVVVASRAHERG--------QIK------------------VDDINSSDFYDEG- 203
            .:|..:|  |||.|:|...::.        |.|                  |.|..:.|...:| 
Zfish   127 PILRANA--RVVNVSSFVSKKSLDQCSAELQAKFRNKDLSEEELCLLMGEFVQDAQAGDHSAKGW 189

  Fly   204 --VAYCQSKLANILFTRELAKRLE----GTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETI 262
              .||..:|:...:.:|..|:.|.    |.|:.:||..||...|::|..                
Zfish   190 PNTAYGTTKIGVTVLSRIQARVLNETRPGDGILLNACCPGWVRTDMAGP---------------- 238

  Fly   263 LRPLLWAVMKTPKNGAQTTLYAALDPD 289
                  ...|:|:.||:|.:|.|:.|:
Zfish   239 ------KAPKSPEEGAETPVYLAMLPE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 76/287 (26%)
NADB_Rossmann 45..323 CDD:304358 76/287 (26%)
cbr1lNP_919360.1 carb_red_PTCR-like_SDR_c 4..277 CDD:187585 76/287 (26%)
adh_short 4..242 CDD:278532 68/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.