DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30495 and CG15629

DIOPT Version :9

Sequence 1:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:254 Identity:63/254 - (24%)
Similarity:104/254 - (40%) Gaps:38/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFRKQTDETGKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFS 100
            :|||..|.:|:|.::|||..|:|:...:..||..|.:.:...|:|.: :...:::.:.|..|...
  Fly    47 RFRKLKDISGQVVLITGGGGGVGRLIALNFARLQARIVIWDINQEAI-KTTVDLLAKHGYDNCKG 110

  Fly   101 RECDLSSLDSIRKFAENFKKEQRVLHILINNAGV-----FWEPH-RLTKEGFEMHLGVNHIGHFL 159
            ...|:|..:.|.:.|....:|...:.|||||||:     |||.| |:.:..:    .:|.|.|:.
  Fly   111 YVVDISDREQIYQRASQVTEEVGPVDILINNAGIVCCKPFWELHDRVIQNTY----NINIISHYW 171

  Fly   160 LTNLLLGVLERSAPSRVVVVASRAHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRL 224
            .....|..:.|:....:|.|.|.....|.....|            |..:|.|.|.|...|...|
  Fly   172 TVKAFLPHMMRNNRGHIVTVGSVTGMLGTYGCSD------------YAATKYACIGFHESLLTDL 224

  Fly   225 EGTG--------VTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPL----LWAVM 271
            :..|        :....:|.|:......|.|...:   .|||.:.|...:    :|.|:
  Fly   225 KAHGYDQIQMSLICPYYINTGMFSGVRPRMMPMLE---PQYVADRIENAVRCNEVWCVL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30495NP_001260785.1 FabG 44..296 CDD:223959 59/246 (24%)
NADB_Rossmann 45..323 CDD:304358 59/245 (24%)
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 58/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.